PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.E00037.3.p
Common NameEUGRSUZ_E00037, LOC104443348
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family Dof
Protein Properties Length: 295aa    MW: 31804.3 Da    PI: 9.3135
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.E00037.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.72.9e-393797262
            zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                      ++++l+cprC+s+ntkfCyynnysl+qPryfCk+CrryWt GG+lrnvPvGgg+rknkk+s
  Eucgr.E00037.3.p 37 PQEQLNCPRCNSNNTKFCYYNNYSLTQPRYFCKTCRRYWTDGGSLRNVPVGGGSRKNKKVS 97
                      6899******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-263295IPR003851Zinc finger, Dof-type
PfamPF027014.2E-333995IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.9754195IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104379IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009639Biological Processresponse to red or far red light
GO:0009845Biological Processseed germination
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MPEVVLITQD TRVVKGMEET SPNACNNRAM LEKRARPQEQ LNCPRCNSNN TKFCYYNNYS  60
LTQPRYFCKT CRRYWTDGGS LRNVPVGGGS RKNKKVSTSS TSSSPSASSR LPDLNPSSVI  120
SHFSAQNPKA GLLYEGQDLN LGFPGTQEYR ATIAQYVQVP KVDPETSSRG PDNNSSAPSS  180
ALELLRNSSS GMGSRGLSLP FLPANIQADS NVLYSSAGFN LQELKPSLGF SMDSRYASAH  240
GVVHQENGGK LLFPFGGMMK QLSSTSGSDQ VDHNGKGQSS SNAYWNGMLG GGSW*
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.E00037.3.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010054991.10.0PREDICTED: dof zinc finger protein DOF2.5 isoform X2
SwissprotQ9ZPY03e-59DOF25_ARATH; Dof zinc finger protein DOF2.5
TrEMBLA0A059BZU70.0A0A059BZU7_EUCGR; Uncharacterized protein
STRINGPOPTR_0014s09640.12e-90(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61850.41e-56Dof family protein